Blog

Knowledge that actually helps.

Articles about web hosting, domains, privacy, WordPress and digital tools for associations and small organisations. Written clearly, without expertise required.

BlogSep 5, 2026

GDPR-Compliant Migration of Your Club Website: From cPanel/Plesk to Virtualmin – Step-by-Step Guide

Learn how to migrate your club website from cPanel or Plesk to Virtualmin in a GDPR-compliant manner. With a detailed step-by-step guide and practical checklist for a smooth transition.

virtualmingdprmigrationclub website
Read more
BlogSep 5, 2026

AI-Powered GDPR-Compliant Association Website: How to Host It with Virtualmin as a High-Availability Cluster

Learn how to use AI to design a GDPR-compliant association website and host it with Virtualmin as a high-availability cluster to avoid outages. Practical tips and tools for a secure and reliable online presence.

virtualmingdprhigh-availabilityaiassociation-website
Read more
BlogSep 5, 2026

Design a GDPR-compliant club website with AI and host it with Virtualmin

Learn how to create a GDPR-compliant club website with AI tools like ChatGPT and Midjourney and host it with Virtualmin on your own server – including practical tips.

virtualmingdprhostingaiclub website
Read more
BlogSep 4, 2026

Virtualmin vs. cPanel, Plesk & Webmin: Why Virtualmin is the Best Choice for Associations

Discover why Virtualmin with its modular architecture and API integration surpasses cPanel, Plesk, and Webmin – ideal for flexibility, security, and GDPR compliance for associations.

virtualminwebhostingassociationcomparison
Read more
BlogSep 4, 2026

Backup Strategies Compared: Virtualmin as a GDPR-Compliant Alternative to Traditional Control Panels for Club Data

Learn how to implement a GDPR-compliant backup strategy for club data with Virtualmin. We compare Virtualmin with classic control panels and show you practical solutions for more data security.

virtualmingdprbackupcontrol panelclub-data
Read more
BlogSep 4, 2026

GDPR-Compliant Server Hardening: Virtualmin against DDoS & Brute-Force Attacks for Association Websites

Learn how to secure your Virtualmin server GDPR-compliant against DDoS and brute-force attacks – without external cloud services. With practical tips, you reliably protect your association's data.

virtualmingdprddos protectionbrute forceserver security
Read more
BlogSep 3, 2026

Virtualmin vs. Cloudron, YunoHost & ISPConfig: The Lean GDPR Solution for Associations

Comparison of server management for associations: Why Virtualmin is more resource-efficient and GDPR-compliant than Cloudron, YunoHost, and ISPConfig – with granular controls and a lean architecture.

virtualminserver managementgdprassociationcomparison
Read more
BlogSep 3, 2026

Virtualmin vs. cPanel, Plesk & Webmin: The GDPR-Compliant All-in-One Solution for Associations

A practical comparison shows: Virtualmin surpasses cPanel, Plesk, and Webmin in automation, security, and cost. Ideal for associations that want to host GDPR-compliantly and budget-friendly.

virtualmingdprhostingassociationcomparison
Read more
BlogSep 3, 2026

GDPR-compliant member area with Virtualmin: Self-hosting without external providers

Learn how to create a GDPR-compliant member area with Virtualmin and self-hosting – including subscription management, forms, and protected downloads, all without external providers.

virtualmingdprdata protectionself-hostingmember area
Read more
BlogSep 2, 2026

AI-Powered Scheduling and Resource Booking in Nextcloud for Associations with Virtualmin, GDPR-Compliant Automation

Learn how to automate scheduling and resource booking in your association with Nextcloud and AI-powered tools – GDPR-compliant and secure on your own server with Virtualmin.

virtualminnextcloudgdprschedulingassociation
Read more
BlogSep 2, 2026

GDPR-compliant calendar and resource management for clubs with Nextcloud and Virtualmin

Learn how to extend Nextcloud with Virtualmin to achieve GDPR-compliant calendar and resource management. Including a booking system for rooms and equipment – without external services.

virtualminnextclouddsgvovereinressourcenverwaltung
Read more
BlogSep 2, 2026

GDPR-Compliant Security Concept for Association Websites with Virtualmin: Backup, 2FA & Access Control

Learn how to implement a GDPR-compliant security concept for your association website with Virtualmin – including backup strategies, two-factor authentication, and access controls for volunteers, all without external services.

virtualmingdprsecuritybackupassociation-website
Read more
BlogSep 1, 2026

GDPR-compliant video conferencing with Nextcloud and Virtualmin: How to set it up

Learn how to extend your Nextcloud instance with Virtualmin for GDPR-compliant video conferencing and live streaming – ideal for club meetings without external providers.

virtualminnextcloudgdprclubvideo conferencing
Read more
BlogSep 1, 2026

The Best Free Admin Tools for Associations: DSGVO-Compliant Self-Hosting with Virtualmin

Discover how your association can host member management, scheduling, and board tasks in a DSGVO-compliant way with free tools like Virtualmin, Nextcloud, and CalDAV – without external services.

virtualmingdpropen-sourceself-hostingassociation
Read more
BlogSep 1, 2026

GDPR-compliant Email Archiving with Virtualmin: How to Set It Up for Your Association

Learn how to set up GDPR-compliant email archiving and encryption for your association with Virtualmin – without external providers and with full control over all data.

virtualminemail archivinggdprassociationencryption
Read more
BlogAug 31, 2026

GDPR-compliant domain management for your association with Virtualmin – without external providers

Learn how to build GDPR-compliant domain management for your association with Virtualmin – including automatic renewal, WHOIS redaction, and DNS security. All without external providers and with full control.

virtualmingdprdomain-managementassociationdns-security
Read more
BlogAug 31, 2026

Securing GDPR-compliant club websites with Virtualmin: Automated updates, Fail2Ban & intrusion detection

Learn how to secure your club website GDPR-compliant with Virtualmin – through automated security updates, Fail2Ban and intrusion detection, without any external services.

virtualmingdprsecurityfail2banclub website
Read more
BlogAug 31, 2026

GDPR-compliant club website: Hosting with Virtualmin, SSL & monitoring without external providers

Learn how to create a GDPR-compliant club website with Virtualmin – including automatic SSL certificates, performance optimization, and server monitoring, all without external providers.

virtualmingdprhostingsslclub website
Read more
BlogAug 30, 2026

Create and host a GDPR-compliant AI website for your association with Virtualmin

Learn how to create a GDPR-compliant and accessible website for your association with Virtualmin. AI automatically generates content according to WCAG, without any external services.

virtualmingdpraccessibilityaiassociation
Read more
BlogAug 30, 2026

GDPR-compliant Club App with Virtualmin: PWA, Push & Offline without Cloud

Learn how to develop a GDPR-compliant club app as a Progressive Web App with Virtualmin – including push notifications and offline features, without cloud dependency.

virtualmingdprclubpwaoffline
Read more
BlogAug 30, 2026

Nextcloud with Virtualmin: GDPR-compliant AI document analysis for association data

Learn how to extend Nextcloud with Virtualmin to include AI-powered document analysis and automatic data classification – GDPR-compliant and ideal for associations. Step-by-step guide including tips on hosting and domains.

virtualminnextcloudgdpraiassociation
Read more
BlogAug 29, 2026

GDPR-compliant club communication with Virtualmin: newsletters, surveys and appointment reminders without external services

Learn how to self-host GDPR-compliant newsletters, member surveys and appointment reminders with Virtualmin – without external services and with full control over your data.

virtualmingdprdata protectionclub-communicationnewsletter
Read more
BlogAug 29, 2026

GDPR-compliant domain migration for associations: Automatically manage WHOIS, DNS & expiry dates with Virtualmin

Learn how to migrate your association's domain in a GDPR-compliant way and automatically check WHOIS data, DNS records, and expiry dates with Virtualmin – for more security and trust.

virtualmingdprassociationdomain-migrationwhois
Read more
BlogAug 29, 2026

GDPR-compliant AI blog for associations with Virtualmin: Automatic content creation, image optimization, and SEO analysis without external data processing

Learn how to create a GDPR-compliant blog for your association with Virtualmin and AI. Automatic content creation, image optimization, and SEO analysis – all without external data processing.

virtualmingdprseoassociation-websiteai blog
Read more
BlogAug 28, 2026

DSGVO-compliant online collaboration for clubs: Nextcloud and Virtualmin in self-hosting

Learn how to build a DSGVO-compliant platform for your club with Nextcloud and Virtualmin. Offer real-time document editing, video conferencing, and secure file sharing – all without external cloud services.

virtualminnextcloudcollaborationdsgvoclub
Read more
BlogAug 28, 2026

GDPR-compliant association management with open-source tools: Virtualmin, member directory, document management & accounting without additional costs

Learn how to design your association management GDPR-compliant with Virtualmin and open-source tools – including member directory, document management, and accounting, all without additional costs.

virtualmingdprdata protectionopen-sourceassociation management
Read more
BlogAug 28, 2026

Domain Extensions and GDPR: How .de, .verein, and New TLDs Strengthen Trust in Your Association's Website

Learn how the choice of domain extension affects GDPR compliance and the trust of your visitors. We compare .de, .verein, and new top-level domains and give tips for your association's website.

gdprweb hostingdomain-extensionsassociationtrust
Read more
BlogAug 27, 2026

GDPR-compliant two-factor authentication with Virtualmin for your club website

Learn how to implement GDPR-compliant two-factor authentication and advanced access controls for your club website with Virtualmin to prevent unauthorized access and data leaks.

virtualmingdprsecurity2faclub website
Read more
BlogAug 27, 2026

A Practical Guide to Migrating from cPanel or Plesk to Virtualmin for Clubs: Step-by-Step Instructions for a GDPR-Compliant Switch without Downtime

Learn how to migrate your club from cPanel or Plesk to Virtualmin without downtime. Step-by-step instructions for a GDPR-compliant transition with minimal risk.

virtualminmigrationdsgvoverein
Read more
BlogAug 27, 2026

Virtualmin & Nextcloud: GDPR-compliant Cloud for Associations with AI Features

Learn how to set up a GDPR-compliant Nextcloud instance for your association with Virtualmin and extend it with AI-powered file management and collaboration features. Step-by-step guide for more data protection and efficiency.

virtualminnextcloudgdpraiassociation
Read more
BlogAug 26, 2026

GDPR-compliant AI chatbots for association websites: How to succeed with Virtualmin

Learn how to use AI chatbots in a GDPR-compliant way on your association's website and why Virtualmin as a secure hosting environment is the ideal basis for this. Practical tips and legal information included.

virtualmingdprdata protectionassociation-websiteai-chatbot
Read more
BlogAug 26, 2026

GDPR-compliant Emergency Strategy for Club Websites with Virtualmin: Backups, Recovery & Incident Response

Learn how to secure your club website with Virtualmin in a GDPR-compliant way: automated backups, quick recovery, and an effective incident response plan against hacker attacks and data loss.

virtualmingdprbackupclubemergency-strategy
Read more
BlogAug 26, 2026

GDPR-Compliant Email Marketing for Associations: How to Succeed with Virtualmin and Double Opt-In

Learn how your association can set up a GDPR-compliant newsletter solution with Virtualmin – including double opt-in and automatic unsubscribe. Stay legally compliant and protect your members' data.

virtualmingdprassociationsemail-marketingdouble opt-in
Read more
BlogAug 25, 2026

Virtualmin for Associations: GDPR-Compliant AI Website with Appointment Booking & Event Management

Learn how to host a GDPR-compliant AI-powered association website for appointment booking and event management with Virtualmin – including automatic data protection logging and backups.

virtualmingdprhostingaiassociation-website
Read more
BlogAug 25, 2026

GDPR-compliant AI website for clubs with Virtualmin: Automation & secure hosting environment

Learn how to create a GDPR-compliant website for your club with AI support and host it on Virtualmin – including backup strategies and security tips.

virtualmingdprbackupai-websiteclub
Read more
BlogAug 25, 2026

GDPR-Compliant AI Image Gallery for Club Websites with Virtualmin

Learn how to build a GDPR-compliant AI-powered image gallery for your club website with Virtualmin. Including automatic alt-text generation and privacy-friendly image optimization.

virtualmingdprclub websiteai-image-galleryalt-text
Read more
BlogAug 24, 2026

GDPR-Compliant Donation Portal for Clubs: With Virtualmin and Automatic Receipt Archiving

Learn how to set up a secure donation and membership fee portal for your club with Virtualmin – including automatic receipt archiving and payment processing without cloud dependency.

virtualmingdprhostingclubdonation portal
Read more
BlogAug 24, 2026

Building a GDPR-Compliant AI-Powered Membership Management with Virtualmin

Learn how to build a GDPR-compliant, AI-powered membership management with Virtualmin that securely processes personal data and automatically updates it – including practical tips for hosting and data protection.

virtualmingdprdata protectionaimembership management
Read more
BlogAug 24, 2026

Creating a GDPR-compliant association website with Virtualmin: Step-by-step guide

Learn how to create a GDPR-compliant association website with member portal, login, role management, and protected file exchange using Virtualmin – including practical tips for data protection and security.

virtualmingdprdata protectionassociation-websitemember portal
Read more
BlogAug 23, 2026

DSGVO-compliant web analytics with Virtualmin: How to host your visitor statistics yourself

Learn how to implement DSGVO-compliant web analytics for your club website with Virtualmin, without Google Analytics. We'll show you step by step how to host Matomo yourself and get privacy-friendly visitor statistics.

virtualmindsgvoclubweb analyticsmatomo
Read more
BlogAug 23, 2026

Virtualmin as a GDPR-Compliant Hosting Panel for Associations: Comparison with Webmin, cPanel, and Plesk

Find out why Virtualmin is ideal for associations: GDPR compliance, automated updates, and security patches. Compare Virtualmin with Webmin, cPanel, and Plesk to find the right hosting panel.

virtualminhosting paneldsgvosicherheitvereine
Read more
BlogAug 23, 2026

Virtualmin vs. cPanel, Plesk & Webmin: The GDPR Advantage for Club Websites

Learn why Virtualmin is the better choice for GDPR-compliant club websites: lean architecture, reduced attack surface, and full control over server data – a detailed comparison.

virtualmingdprhosting-comparisonclub websiteserver-control
Read more
BlogAug 22, 2026

GDPR-compliant AI website for your association: How to do it with Virtualmin

Learn how to set up a GDPR-compliant AI-powered website for your association with Virtualmin – from privacy-friendly AI tools to automated deployment.

virtualmingdprai-websiteassociationdeployment
Read more
BlogAug 22, 2026

Domain Names for Associations: Choose and Renew the Right TLD in a GDPR-Compliant Way with Virtualmin

Learn how associations can use Virtualmin to choose and renew the right top-level domain in a GDPR-compliant way. Tips on TLDs, data protection, and practical tools for your association.

virtualmingdprtldassociationdomain
Read more
BlogAug 22, 2026

GDPR-compliant AI workflow for association websites: From text generation to publication with Virtualmin

Learn how to create and host a GDPR-compliant association website with AI and Virtualmin – from text generation to privacy-friendly publication.

virtualmingdprdata protectionassociation-websiteai-workflow
Read more
BlogAug 21, 2026

Virtualmin as a GDPR-compliant Control Panel for Clubs: Slim, Extensible, and Secure

Virtualmin is a slim, modular control panel that is ideal for clubs. It offers GDPR compliance, automatic updates, and integrated backup management – compared to Webmin, Ajenti, CyberPanel, and VestaCP, it is the stronger choice.

virtualmingdprhostingclubcontrol panel
Read more
BlogAug 21, 2026

Secure Your Club's Web Hosting: Automatically Manage and Renew GDPR-Compliant SSL/TLS Certificates with Virtualmin

Learn how to automatically manage and renew SSL/TLS certificates for your club's web hosting with Virtualmin – GDPR-compliant and without manual effort.

virtualmingdprwebhostingclubssl/tls
Read more
BlogAug 21, 2026

GDPR-compliant survey tools for clubs with Virtualmin: Privacy-friendly voting without additional costs

Discover how your club can conduct GDPR-compliant surveys and votes with Virtualmin and privacy-friendly open-source tools – without additional costs and with full control over the data.

virtualmingdprclubsurvey-toolsprivacy
Read more
BlogAug 20, 2026

Virtualmin and Fail2ban: How to Protect Your Club Website from Brute-Force Attacks and Comply with GDPR

Learn how to protect your club website from brute-force attacks and meet GDPR logging requirements with Virtualmin and Fail2ban. Practical tips for more security.

virtualmingdprfail2banclub websitebrute-force protection
Read more
BlogAug 20, 2026

GDPR-compliant domain registration for associations: WHOIS data protection and .de domains compared

Learn how associations can register their domain GDPR-compliantly. We compare .de domains with ccTLDs and new extensions and show you how to make the best use of WHOIS data protection.

gdprassociationdomain registrationwhois data protectionde domain
Read more
BlogAug 20, 2026

GDPR-compliant data deletion in associations: How to implement the right to erasure with Virtualmin

Learn how to implement automated, GDPR-compliant deletion concepts for association member data with Virtualmin and practically fulfill the right to erasure from Art. 17 GDPR.

virtualmingdprdata protectionassociationdata deletion
Read more
BlogAug 19, 2026

The Best Free GDPR-Compliant Accounting Tools for Clubs: Virtualmin in Comparison

Discover free GDPR-compliant accounting and finance tools for clubs. Learn how to save costs and stay data protection compliant with Virtualmin and open-source solutions.

virtualmingdpraccountingopen-sourceclubs
Read more
BlogAug 19, 2026

GDPR-compliant backup & disaster recovery for club data with Virtualmin

Learn how to create GDPR-compliant backups for club data with Virtualmin, automatically encrypt them, and perform recovery tests – including a step-by-step guide.

virtualmingdprbackupclubdisaster-recovery
Read more
BlogAug 19, 2026

Free GDPR-Compliant Member Management for Clubs with Virtualmin: Privacy-Friendly CRM Alternatives to Paid Tools Compared

Discover how to set up a free and GDPR-compliant member management system for your club with Virtualmin. We compare privacy-friendly CRM alternatives to paid tools and show you the best solutions.

virtualmingdprmember managementclubcrm
Read more
BlogAug 18, 2026

Nextcloud with Virtualmin: GDPR-compliant collaboration for clubs at no extra cost

Learn how to extend Nextcloud with Virtualmin with powerful tools such as collaborative text editing, video conferencing, and file sharing – GDPR-compliant and without additional costs.

virtualminnextclouddsgvovereinkollaboration
Read more
BlogAug 18, 2026

Virtualmin & GDPR: Secure Data Recovery for Your Association

Learn how to ensure GDPR-compliant data recovery for your association with Virtualmin and automated backup strategies – from encrypted offsite backups to ransomware protection.

virtualmingdprbackupassociationransomware
Read more
BlogAug 18, 2026

Extending Nextcloud with Virtualmin: Scale OnlyOffice, Calendar & Contacts for Associations in a GDPR-compliant Way

Learn how to extend Nextcloud with Virtualmin using OnlyOffice, calendar, and contacts to promote collaboration in your association – GDPR-compliant and scalable.

virtualminnextcloudgdpronlyofficeassociation
Read more
BlogAug 17, 2026

Virtualmin for Associations: GDPR-compliant, secure & efficient compared to cPanel, Plesk and ISPConfig

Find out why Virtualmin is the better choice for associations: GDPR compliance, security and efficiency in managing multiple websites and user accounts – in direct comparison to cPanel, Plesk and ISPConfig.

virtualmingdprwebhostingassociationcomparison
Read more
BlogAug 17, 2026

GDPR-compliant security monitoring for club websites with Virtualmin

Learn how to automate GDPR-compliant security monitoring for your club website: with Virtualmin, log analysis, and real-time alerts for suspicious activities.

virtualmingdprlog analysisclubsecurity monitoring
Read more
BlogAug 17, 2026

GDPR-compliant two-factor authentication for association websites with Virtualmin and TOTP

Learn how to set up GDPR-compliant two-factor authentication for your association website with Virtualmin and TOTP. Step-by-step guide and tips for more security.

virtualmingdprsecurity2fatotp
Read more
BlogAug 16, 2026

The Right Domain Extension for Your Club: GDPR-Compliant & Legally Secure

Learn how to choose the right domain extension for your club and manage it GDPR-compliantly – including tips on expiration, owner changes, and legal pitfalls.

gdprtldclubdomainlegal
Read more
BlogAug 16, 2026

AI Website Builders & Virtualmin: Create and Host GDPR-Compliant Landing Pages for Club Events

Learn how to quickly and GDPR-compliantly create and host landing pages for your club events using AI-powered website builders and Virtualmin. Including tips for choosing the right hosting.

virtualmingdprclubai-website-builderlanding-page
Read more
BlogAug 16, 2026

GDPR-compliant association communication: Which domain ending suits your association?

Find out how the choice of domain ending affects your association's GDPR-compliant communication. We compare .de, .org, .verein, and generic TLDs with regard to data protection, trust, and legal certainty.

gdprweb hostingdata protectionassociationdomain-endings
Read more
BlogAug 15, 2026

GDPR-compliant club planner with Virtualmin: manage appointments, members & reminders for free

Discover how to set up a free, GDPR-compliant appointment and member management planner for your club with Virtualmin – including automated reminders and calendar synchronization.

virtualminnextcloudgdprclub managementcalendar
Read more
BlogAug 15, 2026

GDPR-Compliant Email Marketing for Associations: Automated Newsletters with Virtualmin and SPF/DKIM

Learn how to set up GDPR-compliant email marketing for your association. Use Virtualmin for automated newsletters and secure your sender reputation with SPF and DKIM.

virtualmingdprnewsletterassociationemail-marketing
Read more
BlogAug 15, 2026

GDPR-compliant security for clubs: Easily set up Fail2Ban and intrusion detection with Virtualmin

Learn how to protect your club from brute-force attacks with Fail2Ban and intrusion detection on Virtualmin – without any command line knowledge and GDPR-compliant.

virtualmingdprsecurityfail2banclub
Read more
BlogAug 14, 2026

GDPR-Compliant AI Website Builders: Secure Hosting with Virtualmin for Associations

Learn how associations can use AI-based website builders in a GDPR-compliant way – with automatic data minimization and secure hosting on Virtualmin. Includes practical tips and a checklist.

virtualmingdprdata protectionassociationai-website-builder
Read more
BlogAug 14, 2026

GDPR-compliant Nextcloud on Virtualmin: Automated Updates & Security Scans for Clubs

Learn how to run Nextcloud GDPR-compliant on Virtualmin – with automated updates and security scans. We compare the maintenance effort with manual processes and show you the benefits for clubs.

automationvirtualminnextcloudgdprclub
Read more
BlogAug 14, 2026

GDPR-Compliant Domain Expiration Management for Associations: Automated Renewal and Timely Warnings with Virtualmin Compared to Manual Processes

Learn how associations can automate their domain expiration management with Virtualmin to stay GDPR-compliant and avoid outages. We compare automated solutions with manual processes.

automationvirtualmingdprdomain-managementassociations
Read more
BlogAug 13, 2026

GDPR-Compliant Webmail Setup for Associations: Roundcube, RainLoop & 2FA on Virtualmin

Learn how to set up webmail clients like Roundcube and RainLoop in a GDPR-compliant manner, with two-factor authentication and automatic archiving – ideal for associations on Virtualmin.

virtualmingdprwebmailroundcuberainloop
Read more
BlogAug 13, 2026

GDPR-compliant AI chatbots in Virtualmin for clubs: How integration succeeds

Learn how to integrate AI chatbots and forms into Virtualmin in a data protection compliant way for your club. Including hosting optimization and typical pitfalls.

virtualmingdprhostingclubai-chatbot
Read more
BlogAug 13, 2026

GDPR-Compliant Backup Strategies for Association Websites: Virtualmin in Comparison to Webmin and HestiaCP

Learn how to create GDPR-compliant backups for your association website with Virtualmin – including automated rotation, offsite storage, and restore tests. A comparison with Webmin and HestiaCP shows the advantages and disadvantages.

virtualmingdprbackupwebhostingassociation-website
Read more
BlogAug 12, 2026

The Best Free Management Tools for Clubs – GDPR-Compliant Hosting on Virtualmin

Discover free tools for member management, accounting, and scheduling. Learn how to host them GDPR-compliantly on your own Virtualmin server.

virtualmingdpropen-sourceclub managementself-hosting
Read more
BlogAug 12, 2026

GDPR-Compliant Performance Optimization for AI Websites on Virtualmin: Caching & Image Compression

Learn how to optimize AI-generated websites in a GDPR-compliant way: caching strategies and automatic image compression on Virtualmin for clubs and small businesses – explained practically.

virtualmingdprperformancecachingimage-compression
Read more
BlogAug 12, 2026

GDPR-compliant Domain Redirect and Subdomain Strategy for Associations

Learn how to stay GDPR-compliant with automatic 301 redirects and a clever subdomain strategy. We show you legal pitfalls and practical solutions for associations.

gdprassociationdomain-redirectsubdomain
Read more
BlogAug 11, 2026

Seamless Integration of Nextcloud with Collabora Online and OnlyOffice for GDPR-Compliant Real-Time Document Editing

Learn how to integrate Nextcloud with Collabora Online or OnlyOffice to edit documents in real time in a GDPR-compliant manner – ideal for associations and small businesses.

nextcloudonlyofficedsgvocollaboradokumentenbearbeitung
Read more
BlogAug 11, 2026

Install Nextcloud on Virtualmin: GDPR-compliant cloud for clubs

Learn how to install Nextcloud step by step on Virtualmin. This gives your club a GDPR-compliant file sharing, calendar, and contact management – without cloud dependency.

virtualminnextcloudgdprcloudclub
Read more
BlogAug 11, 2026

GDPR-compliant SSL certificates for association websites: Automation with Virtualmin compared to Let's Encrypt and paid certificates

Learn how to automate SSL certificates and HTTPS enforcement for your association website in a GDPR-compliant way with Virtualmin. We compare Let's Encrypt, paid certificates, and give practical tips for secure operation.

virtualmingdprssllets-encryptassociation-website
Read more
BlogAug 10, 2026

GDPR-Compliant AI Website Designs with Virtualmin: Workflow Automation from Idea to Launch

Learn how to create GDPR-compliant websites with Virtualmin and AI tools and automate the entire workflow from idea to launch – including performance optimization and content security.

virtualmingdprperformanceai designworkflow automation
Read more
BlogAug 10, 2026

Virtualmin Hardening for Associations: GDPR-Compliant Security Without Command Line Knowledge

Learn how to secure your Virtualmin server for your association in a GDPR-compliant way – with two-factor authentication, IP-based access controls, and automatic security updates, all without command line knowledge.

virtualmin2fadsgvosicherheitverein
Read more
BlogAug 10, 2026

The Ultimate Workflow for GDPR-Compliant Email Migration and Management on Virtualmin Compared to Webmin, ISPConfig, and HestiaCP – Including Automated Spam and Backup Solutions

Learn how to migrate and manage emails GDPR-compliantly – with Virtualmin compared to Webmin, ISPConfig, and HestiaCP. Including tips on spam filters and automated backups.

virtualmingdprbackupspam-filteremail-migration
Read more
BlogAug 9, 2026

GDPR-compliant AI images and fonts on Virtualmin: The guide for associations and small businesses

Learn how to integrate AI-generated images and fonts into your website design in a GDPR-compliant way – with automatic license checking and performance optimization on Virtualmin. Ideal for associations and small businesses.

virtualmingdprperformanceai-imagesgdpr-compliant
Read more
BlogAug 9, 2026

The 10 Most Common Web Hosting Security Mistakes for Associations & Small Businesses – and How to Fix Them in a GDPR-Compliant Way with Virtualmin

Discover the ten most common web hosting security mistakes that endanger associations and small businesses. Learn how to fix them in a GDPR-compliant way with Virtualmin and optimally protect your website.

virtualmingdprsecuritywebhostingassociation
Read more
BlogAug 9, 2026

Domain Names for Associations & Small Businesses: Selection, Management & GDPR Tips

Learn how to choose and manage the perfect domain name for your association or small business – including GDPR-compliant WHOIS privacy, automatic renewal, and strategic subdomains.

gdprweb hostingsubdomainsdomain namesassociation
Read more
BlogAug 8, 2026

GDPR-Compliant WordPress Migration to Virtualmin: Automated Backups and Failover for Associations & Small Businesses

Learn how to migrate your WordPress website GDPR-compliantly to Virtualmin, set up automated backups, and implement failover strategies for maximum security – ideal for associations and small businesses.

virtualmingdprfailoverwordpressbackups
Read more
BlogAug 8, 2026

The Right Domain Extension: Tips for Clubs, Start-ups and Local Businesses

Choosing the right domain extension is crucial for the success of your website. Find out which TLD makes sense for clubs, start-ups and local businesses – from classic extensions to new ones like .club and .verein.

startupsdomain-extensionstldclubslocal-businesses
Read more
BlogAug 8, 2026

GDPR-Compliant AI Design Assets in Virtualmin: License Checking & Hosting Optimization

Learn how to use AI-generated design assets in Virtualmin in a GDPR-compliant manner, set up automatic license checks, and optimize your hosting for fast load times.

virtualmingdprai designhosting optimizationlicense check
Read more
BlogAug 7, 2026

Virtualmin vs. Plesk vs. DirectAdmin: The Fair Comparison for Clubs and Small Businesses

Discover why Virtualmin is the better choice for clubs and small businesses: modular architecture, lower costs, and GDPR-compliant self-management – a practical comparison.

virtualmingdprhosting-comparisonpleskdirectadmin
Read more
BlogAug 7, 2026

Virtualmin Security: Closing the Most Important Security Gaps in a GDPR-Compliant Manner

Virtualmin configurations are often targets of attacks. Learn how to close security gaps with hardening, automated updates, and regular audits while remaining GDPR-compliant.

virtualmingdprsecurityhardeningupdates
Read more
BlogAug 7, 2026

Virtualmin vs. cPanel: The Practical Guide to GDPR-Compliant Migration and Efficient Server Management

Discover how Virtualmin with integrated backup management and easy domain management outperforms classic control panels. Learn how to migrate from proprietary panels in a GDPR-compliant way and save costs.

virtualmingdprhostingbackupmigration
Read more
BlogAug 6, 2026

Enhanced Nextcloud Security for Associations: GDPR-Compliant with 2FA, Fail2ban, and Encrypted Backups on Your Own Server

Learn how to secure Nextcloud for your association in a GDPR-compliant way: two-factor authentication, Fail2ban, and encrypted backups – explained step by step.

gdprfail2ban2fanextcloud-securitybackups
Read more
BlogAug 6, 2026

GDPR-compliant AI website designs: Automation with Virtualmin

Learn how to automate AI-generated website designs in a GDPR-compliant way. Practical workflows for image generation and content optimization on your own server with Virtualmin.

virtualmingdprwebsite-designai-automation
Read more
BlogAug 6, 2026

Deploy AI-generated website layouts automatically on Virtualmin – Here's how to do it GDPR-compliant

Learn how to create responsive layouts with AI tools and seamlessly deploy them on your Virtualmin server – including performance tuning and GDPR-compliant data processing.

virtualmingdprairesponsivewebdesign
Read more
BlogAug 5, 2026

Open-Source Management Tools for Associations: GDPR-Compliant on Your Own Server with Docker and Virtualmin

Discover the best open-source tools for member management, accounting, and document management. Learn how to install them GDPR-compliant on your own server with Virtualmin and Docker.

virtualmingdpropen-sourceassociation managementdocker
Read more
BlogAug 5, 2026

Open-Source Web Hosting Panels for Associations 2025: Virtualmin, CloudPanel & aaPanel Compared

Discover the best open-source web hosting panels for associations in 2025. We compare Virtualmin, CloudPanel, and aaPanel regarding GDPR compliance, costs, and user-friendliness.

virtualmingdprassociationsopen-source-web-hostingcloudpanel
Read more
BlogAug 5, 2026

The Best Nextcloud Apps for Small Teams: How to Collaborate Efficiently

Discover the best Nextcloud apps for collaborative work in small teams – from OnlyOffice to Deck to Calendar and Contacts – and how to configure them optimally on your VPS server.

nextcloudvpsonlyofficecollaborationteamwork
Read more
BlogAug 4, 2026

Self-Hosting AI-Powered Websites Step by Step: The Complete Workflow from Initial Design Idea to Going Live with Virtualmin

Learn how to create a website with AI support and host it yourself with Virtualmin. The complete workflow from idea to going live – explained step by step.

virtualminwebhostingworkflowai-websitesself-hosting
Read more
BlogAug 4, 2026

Highly Available WordPress Website with Virtualmin and Failover – How to Do It Without Expensive Cloud Services

Learn how to build a highly available WordPress website for your small business with Virtualmin and automated failover strategies – without expensive cloud services. Step-by-step guide and practical tips.

virtualminvpshigh-availabilityfailoverwordpress
Read more
BlogAug 4, 2026

Webhosting Costs in View: How to Plan Your Budget Without Nasty Surprises

Webhosting can be more expensive than you think – hidden costs often lurk in the fine print. Learn how to plan transparently as an association or small business and avoid unnecessary expenses.

small-businesseswebhosting-costsbudget-planningassociationstransparency
Read more
BlogAug 3, 2026

The 7 Best Open Source Tools for Club Communication, Scheduling, and Newsletters – GDPR-Compliant Self-Hosting

Discover 7 free open source tools for club communication, scheduling, and newsletter distribution. Learn how to host them GDPR-compliant on your own server and thus keep control over your data.

gdpropen-sourceclub-communicationnewsletterscheduling
Read more
BlogAug 3, 2026

Choosing Domain Prefixes Strategically: www, Subdomains, and IDNs for Maximum Discoverability and Brand Rights

Learn how to strategically use domain prefixes such as www, subdomains, and IDNs to improve your discoverability and secure brand rights. Including practical tips.

seodomain-prefixessubdomainsidnsbrand-rights
Read more
BlogAug 3, 2026

Virtualmin vs. Webmin, VestaCP, HestiaCP and ISPConfig: The Ultimate Comparison for Advanced Server Administration

Discover why Virtualmin, thanks to its modular architecture and seamless Webmin integration, is the best choice for automated workflows and multi-server management. Compare the top panels in detail.

virtualminmulti-serverwebminhosting-comparisonserver-administration
Read more
BlogAug 2, 2026

Automatically Renew SSL Certificates with Let's Encrypt in Virtualmin and Centrally Manage Multiple Domains

Learn how to automatically renew SSL certificates with Let's Encrypt in Virtualmin and centrally manage multiple domains. Step-by-step guide with tips for optimal security.

virtualminsslletsencryptautomatic renewalmultiple domains
Read more
BlogAug 2, 2026

GDPR-compliant club website: optimally secure and accelerate with Virtualmin, SSL, HTTP/2 and Brotli

Learn how to make your club website GDPR-compliant with Virtualmin and automated SSL certificates, and significantly improve loading times with HTTP/2 and Brotli compression.

virtualmingdprsslhttp/2brotli
Read more
BlogAug 2, 2026

Free Management Tools for Clubs: The 10 Best Open-Source Solutions for Member Management, Finances, and Events on Your Own Server

Discover the 10 best open-source tools for club management. From member management to finances to events – all solutions run on your own server and are free.

open-sourceclub managementmember managementevent managementfinances
Read more
BlogAug 1, 2026

The Best Domain Extension for Your Business: .de, .com, or .org?

Which domain extension suits your business? We compare .de, .com, and .org in terms of SEO, brand trust, and local audiences – with concrete recommendations for small businesses and freelancers.

domain-selectionseotop-level-domainbrand-trustlocal-audiences
Read more
BlogAug 1, 2026

Virtualmin: Failover and Backup Strategy for Small Businesses – Without Expensive Add-ons

Discover how Virtualmin implements a complete failover and backup strategy for small businesses with just a few clicks – while Plesk, DirectAdmin, and cPanel require expensive add-ons.

virtualminbackupwebhostingfailoversmall-businesses
Read more
BlogAug 1, 2026

Virtualmin vs. Plesk vs. DirectAdmin: The Cost-Effective and Flexible Alternative for Small Businesses

Discover Virtualmin as a flexible and affordable hosting management solution. We compare interfaces, backups, and scalability – ideal for small businesses.

virtualminwebhostingplesk-alternativehosting-comparison
Read more
BlogJul 31, 2026

Designing Accessible Websites with AI Tools and Hosting Them on Your Own Server

Learn how to create an accessible website with AI-powered design tools and then host it on your own server using Virtualmin. Including automatic accessibility testing and performance optimization.

virtualminhostingperformanceai designaccessibility
Read more
BlogJul 31, 2026

AI Design Tools & Virtualmin: Create a Modern Website and Self-Host It

Learn how to design a modern website in no time with AI tools like Figma AI and Durable, and then host it on your own server with Virtualmin, automatic SSL certificates, and optimized performance.

virtualminperformancesslai designcreate website
Read more
BlogJul 31, 2026

The Best Nextcloud Extensions for Automated Backups and Data Recovery on VPS Servers for Small Teams

Discover the best Nextcloud extensions for automated backups and data recovery on VPS servers. Perfect for small teams looking to manage their data securely and efficiently.

automationsmall teamsnextcloud backupsvps serverdata recovery
Read more
BlogJul 30, 2026

Virtualmin vs. Competitors in Detail: Why Virtualmin Clearly Leads in Security, Modularity, and Cost Control

Virtualmin offers more security, modularity, and cost control compared to cPanel, Plesk, and other web hosting panels. Find out why Virtualmin is the better choice for your hosting.

virtualminsecuritycost-controlwebhosting comparisonhosting panel
Read more
BlogJul 30, 2026

Why Virtualmin and Webmin Are Better for Small Organizations Than cPanel

Discover why Virtualmin and Webmin are the more flexible and secure choice for small organizations. Learn how to save costs and maintain full control with these tools.

virtualminsecuritywebmincpanel alternativeshosting control panel
Read more
BlogJul 29, 2026

Optimal Loading Times for Nextcloud on Shared Hosting through Caching and Compression

Learn how to drastically improve loading times of your Nextcloud on shared hosting with caching and compression. Tips for faster work and better performance.

nextcloudshared-hostingperformancecachingcompression
Read more
BlogJul 29, 2026

Design modern websites with AI tools and host them on your own server: How it's done

Learn how to create a modern website using AI-powered tools like website builders and design assistants, and securely host it on your own server. Step-by-step guide for beginners.

ai-toolswebhostingai-websitewebsite-designown-server
Read more
BlogJul 29, 2026

Optimizing Nextcloud for Small Teams: The Best Apps and Integrations

Learn how to enhance Nextcloud with practical apps and integrations for your small team. From calendar to collaboration to security – we show you the best extensions.

productivitynextcloudteamworkappsintegrations
Read more
BlogJul 4, 2026

Virtualmin: Setting Up a Secure Network for Your Organization

Learn in this guide how to set up a secure network for your organization with Virtualmin. From installation to configuration of firewalls and SSL certificates.

virtualminserver managementsslnetwork securityorganization
Read more
BlogJul 4, 2026

Virtualmin: Manage Custom PHP Versions per Domain

Learn how to set an individual PHP version for each domain with Virtualmin and avoid compatibility issues. Perfect for developers and webmasters.

virtualminwebhostingphp-versionsdomain-managementcompatibility
Read more
BlogJul 4, 2026

Advanced Spam Filter Settings in Virtualmin for Small Organizations

Learn how to configure advanced spam filters in Virtualmin to protect your small organization from unwanted emails. Step-by-step guide with tips.

virtualminsmall organizationemail-securityspam-filterserver-configuration
Read more
BlogJul 3, 2026

Setting up Nextcloud on Shared Hosting for Small Teams

Learn how to install Nextcloud on shared hosting, enable file versions, and set sharing permissions for your team – without a VPS.

nextcloudshared-hostingsmall teamsfile versionssharing permissions
Read more
BlogJul 3, 2026

Setting up Email Forwarding and Catch-All Addresses in Virtualmin

Learn how to set up email forwarding and catch-all addresses in Virtualmin. Ideal for small businesses that don't want to miss any emails. Step-by-step guide.

virtualminemail-forwardingsmall-businesscatch-allemail-setup
Read more
BlogJul 3, 2026

Virtualmin for Beginners: Setting Up a Virtual Server

Learn how to set up your first virtual server with Virtualmin. From installation to management – this guide helps you get your website online quickly.

virtualminvpsweb hostingserver setupbeginners
Read more
BlogJul 2, 2026

Configuring Email Filter Rules in Virtualmin for Small Organizations

Learn how to set up advanced email filter rules with Virtualmin to block spam, prevent phishing, and enhance your organization's security.

virtualminsmall organizationsemail-filterspam-protectionphishing
Read more
BlogJul 2, 2026

Free Open-Source Tools for Email, Server, and Website Management

Learn how to efficiently integrate email, server, and website management for your small organization using Virtualmin and other open-source tools – step by step.

virtualminserver managementemail serverwebhostingopen-source
Read more
BlogJul 2, 2026

Virtualmin Integration: Email, Web Hosting, and Server Management for Small Organizations

Learn how to bundle email, web hosting, and server management in one instance with Virtualmin – ideal for small teams wanting to save costs and retain control.

virtualminserver managementsmall organizationweb hostingemail
Read more
BlogJul 1, 2026

Nextcloud on VPS: Data Protection and Access Control for Small Teams

Learn how to set up Nextcloud on your VPS to securely share data and control access. Perfect for small teams that take data protection seriously.

nextcloudvpsteamdatenschutzzugriffskontrolle
Read more
BlogJul 1, 2026

Email Archiving with Virtualmin for Small Organizations

Learn how to set up and manage an efficient email archiving strategy for your small organization using Virtualmin – including tips for compliance and storage.

virtualminserver managementemail archivingcompliancesmall-business
Read more
BlogJul 1, 2026

Troubleshooting Email Delivery Problems with Virtualmin

Email delivery issues can cripple a small organization's operations. This guide helps you identify and fix the most common causes with Virtualmin.

virtualminspfemail deliverytroubleshootingdns
Read more
BlogJun 30, 2026

Setting Up Email Forwarding with Virtualmin – Guide for Small Organizations

Learn how to create email forwarding in Virtualmin to automatically redirect incoming messages to other addresses – ideal for teams and associations.

virtualminsmall organizationwebhostingemail-forwarding
Read more
BlogJun 30, 2026

Automated Backup Workflow with Virtualmin for Small Organizations

Learn how to set up a reliable automated backup workflow with Virtualmin – perfect for small organizations looking to protect their data.

automationvirtualminbackupsmall organizationsworkflow
Read more
BlogJun 30, 2026

Complete Solution for Small Organizations: Email, Server, and Website from One Source

Learn how small organizations benefit from an integrated solution for email, server, and website. Save time, costs, and stress with a single provider.

small organizationserveremailwebsitecomplete solution
Read more
BlogJun 29, 2026

Optimal Email Security for Small Businesses: Configuring SPF, DKIM, and DMARC Correctly

Learn how to secure your email communication with SPF, DKIM, and DMARC, prevent phishing, and improve deliverability. A guide for small businesses.

spfdkimdmarcemail-securitysmall-businesses
Read more
BlogJun 29, 2026

Virtualmin vs. cPanel: Modular Architecture and Cost Savings for Small Businesses

Virtualmin offers a modular, cost-effective alternative to cPanel for small businesses. Learn how its architecture and pricing benefit your budget and requirements.

virtualminwebhostingcpanelcost savingsmodular-architecture
Read more
BlogJun 29, 2026

5 Free AI Tools for Startups: Automate Social Media Planning

Discover 5 free AI tools that let you automate your social media planning and content creation as a startup. Save time and increase your reach.

ai-toolsautomationstartupssocial-mediacontent-creation
Read more
BlogJun 28, 2026

Nextcloud on Shared Hosting: Setup with SSL and Performance Tuning

Learn how to set up Nextcloud on shared hosting, enable automatic SSL encryption, and optimize performance for small teams – including tips for choosing the right hosting.

nextcloudshared-hostingperformancesslsmall teams
Read more
BlogJun 28, 2026

cPanel vs Virtualmin: Modular Architecture and Cost Savings for Small Organizations

Looking for a web hosting control panel that is flexible and affordable? Our comparison shows why Virtualmin with its modular architecture is often the better choice for small organizations.

virtualminwebhostingcpanelcost comparisonmodular
Read more
BlogJun 28, 2026

Install Nextcloud on VPS: Security Updates and Firewall

Learn how to install Nextcloud on your VPS, set up automated security updates, and configure a firewall – for a secure and reliable cloud solution.

nextcloudvpsfirewallinstallationsecurity updates
Read more
BlogJun 27, 2026

Optimize Nextcloud on VPS: Scaling & Failover for Teams

Learn how to optimize Nextcloud on a VPS with automatic scaling and failover for growing teams. Tips on performance, load balancing, and high availability.

nextcloudvpsscalingfailoverteam
Read more
BlogJun 27, 2026

Nextcloud on Shared Hosting: First Steps for Beginners

Learn how to install, configure, and optimize Nextcloud on your shared hosting for best performance. A beginner's guide with practical tips.

nextcloudshared-hostinginstallationperformance tuningguide
Read more
BlogJun 27, 2026

Setting up Nextcloud on a VPS: Security & Performance for Small Organizations

Learn how to manually install Nextcloud on your VPS, optimally secure it, and configure it for performance for small teams. Includes hardening tips and backup strategy.

nextcloudvpssecurityperformanceguide
Read more
BlogJun 26, 2026

10 Free AI Tools for Startup Teams to Optimize Project Management and Collaboration

Discover 10 powerful, free AI tools that help your startup team optimize project management and collaboration. From task management to communication – find the best helpers here.

ai-toolsfreestartupproject-managementcollaboration
Read more
BlogJun 26, 2026

The Ultimate Guide to Choosing the Right Network Hardware for Small Organizations on a Budget

Discover how to choose the perfect network hardware for your small organization on a tight budget. Tips on routers, switches, access points, and more.

small organizationnetwork hardwarebudgetrouterswitch
Read more
BlogJun 26, 2026

Optimizing Email Protocols IMAP, POP3, and SMTP

Learn how to efficiently manage your business emails with IMAP, POP3, and SMTP. We show you the differences and provide tips for optimal configuration.

imappop3smtpemail configurationemail protocols
Read more
BlogJun 25, 2026

7 Free AI Tools for Automating Invoicing and Accounting

Discover 7 free AI tools that help startups automate invoicing and accounting. Save time and avoid errors with these smart solutions.

ai-toolsautomationstartupsaccountinginvoicing
Read more
BlogJun 25, 2026

Package Management under Linux: apt, yum and dnf Compared

Learn how the package management tools apt, yum and dnf differ. We show you the advantages and disadvantages for various Linux distributions and help you choose.

linuxpackage managementaptyumdnf
Read more
BlogJun 25, 2026

Scalable Network Architecture for Startups on a Small Budget

Learn how to build a flexible and cost-efficient network architecture as a startup that grows with your company. Tips on cloud usage and virtualization.

startupcloudnetwork architecturescalablebudget
Read more
BlogJun 24, 2026

Automate Server Tasks with Virtualmin API Scripts

Learn how to efficiently automate recurring server tasks with Virtualmin API scripts. Save time and avoid errors with clever scripts.

automationvirtualminapiwebhostingserver-scripts
Read more
BlogJun 24, 2026

Optimizing Nextcloud on Shared Hosting: Redis Caching and Cron Jobs

Learn how to set up Nextcloud on shared hosting with Redis caching and cron jobs for maximum performance. Tips for fast synchronization and stable usage.

nextcloudshared-hostingcron jobsredis cachingperformance optimization
Read more
BlogJun 24, 2026

Multi-Server Management in Virtualmin: How to Centrally Manage Multiple Domains

Learn how to centrally manage multiple servers and domains with Virtualmin. Step-by-step guide for efficient multi-server management.

virtualminserver managementmulti-serverdomainscentral-management
Read more
BlogJun 23, 2026

Advanced Backup Strategies in Virtualmin for Reliable Data Protection

Learn how to implement advanced backup strategies with Virtualmin to secure your data and quickly restore it in an emergency. Includes tips for automation and external storage.

virtualminhostingbackupdata protectionrestoration
Read more
BlogJun 23, 2026

Cost and Time Savings through Integrated Solutions for Small Organizations

Learn how small organizations can save time and money with bundled email, server, and website solutions. Tips for choosing the right provider.

web hostingcost savingsemail hostingtime savingsintegrated solutions
Read more
BlogJun 23, 2026

The Guide to Setting Up SPF, DKIM, and DMARC for Improved Email Deliverability on Shared Hosting

Learn how to improve your email deliverability on shared hosting with SPF, DKIM, and DMARC. Step-by-step guide for beginners.

shared-hostingspfdkimdmarcemail-deliverability
Read more
BlogJun 22, 2026

All-in-One Platforms for Small Organizations: Email, Server & Website Comparison

Looking for an all-in-one solution for email, server, and website? We compare the best platforms for small organizations and show you what to look out for.

small organizationall-in-oneemail hostingweb hosting comparisonwebsite builder
Read more
BlogJun 22, 2026

Security Updates Compared: Ubuntu LTS vs CentOS Stream vs Debian Stable

Which Linux distribution provides the best security updates for web hosting? We compare Ubuntu LTS, CentOS Stream, and Debian Stable in terms of timeliness, support, and stability.

webhostingsecurity updatesubuntu-ltscentos-streamdebian-stable
Read more
BlogJun 22, 2026

Running Nextcloud Securely on Shared Hosting

Learn how to secure Nextcloud on shared hosting with automatic updates and security scans. Tips for updates, scans, and configuration.

nextcloudshared-hostingsecuritycloudautomatic updates
Read more
BlogJun 21, 2026

Virtualmin vs cPanel: Security Features Compared – Firewall & Fail2Ban

Learn how Virtualmin and cPanel compare in terms of security. We highlight Virtualmin's integrated firewall and Fail2Ban support and show you the differences.

virtualminfirewallsecurityfail2bancpanel
Read more
BlogJun 21, 2026

Free All-in-One Platforms for Small Organizations

Discover free platforms that combine email, server, and website. Ideal for small organizations with limited budgets.

serverfree-platformsall-in-oneemailwebsite
Read more
BlogJun 21, 2026

5 Free AI Tools for Startups to Optimize Customer Communication and Support Tickets

Discover 5 powerful, free AI tools that help you as a startup improve customer communication and handle support tickets more efficiently.

ai-toolsstartupsfreecustomer-communicationsupport-tickets
Read more
BlogJun 20, 2026

The Ultimate Guide to Migrating from cPanel to Virtualmin

Switch from cPanel to Virtualmin: Save costs and gain flexibility. Our guide shows you step by step how to migrate successfully.

virtualminwebhostingcpanelmigrationcost savings
Read more
BlogJun 20, 2026

Advanced Virtualmin Features: DNS Clustering and Load Balancing for High Availability

Learn how to maximize the availability of your websites with DNS clustering and load balancing in Virtualmin. Step-by-step guide for beginners and professionals.

virtualminload-balancingwebhostingdns-clusteringhigh-availability
Read more
BlogJun 20, 2026

Cron Jobs in Virtualmin: Automated System Tasks Made Easy

Learn how to set up and manage cron jobs with Virtualmin to automatically execute recurring tasks like backups or updates. Ideal for admins and web developers.

automationvirtualminserver managementweb hostingcron jobs
Read more
BlogJun 19, 2026

Fix Email Delivery Problems in Virtualmin: Log Analysis & Checks

Learn how to solve common email delivery problems in Virtualmin with log analysis and configuration checks. Step-by-step guide for admins.

virtualminemail deliverytroubleshootinglog analysismail server
Read more
BlogJun 19, 2026

Setting up Nextcloud on Shared Hosting: Step-by-Step Guide

Learn how to install Nextcloud on shared hosting, automatically scale PHP resources, and optimize cron jobs for a high-performance cloud solution.

nextcloudshared-hostingphpcron jobscloud installation
Read more
BlogJun 19, 2026

Real-time Document Editing on VPS with OnlyOffice or Collabora Online

Learn how to collaborate on documents in real time on your VPS with OnlyOffice or Collabora Online – perfect for teams and freelancers.

nextcloudvpsonlyofficecollabora-onlinereal-time collaboration
Read more
BlogJun 18, 2026

Virtualmin vs cPanel: Automation Features Compared

Discover the advanced automation features of Virtualmin compared to cPanel. Learn how to manage your server more efficiently and save costs with Virtualmin.

automationvirtualminserver managementcpanelweb hosting
Read more
BlogJun 18, 2026

Nextcloud on Shared Hosting: Performance Tuning Despite Shared Resources

Learn how to optimally set up Nextcloud on shared hosting and maximize performance with caching, PHP settings, and database tuning.

nextcloudshared-hostingoptimizationperformance tuningcaching
Read more
BlogJun 18, 2026

Virtualmin vs. cPanel: Better Cost Control for Resellers

Virtualmin offers resellers and agencies a cost-effective alternative to cPanel. Learn how to manage multiple client websites with Virtualmin and save real money.

virtualmincpanelreseller-hostingcost-controlresource-management
Read more
BlogJun 17, 2026

Setting up Nextcloud on a VPS: SSL & Database Optimization

Learn how to install Nextcloud on your VPS, automatically manage SSL, and optimize database performance for maximum speed.

nextcloudvpsoptimizationssldatabase
Read more
BlogJun 17, 2026

Setting up SPF, DKIM, and DMARC in Virtualmin for Better Deliverability

Learn how to configure SPF, DKIM, and DMARC in Virtualmin to improve your email deliverability and protect your domain from abuse.

virtualminspfdkimdmarcemail-deliverability
Read more
BlogJun 17, 2026

5 Free AI Tools for Accounting and Invoice Management

Discover 5 free AI tools that help startups with accounting and invoice management. Save time and avoid errors with smart automation.

ai-toolsstartupsfreeaccountinginvoice-management
Read more
BlogJun 16, 2026

Discovering Virtualmin Interface: Dashboard, Templates & User Management

Get to know Virtualmin: From login to dashboard, server templates, and user management – a practical guide for beginners.

virtualmindashboardserver templatesuser managementwebhosting
Read more
BlogJun 16, 2026

5 Free AI Tools for Startups: Automate Marketing Content & Social Media Posts

Discover five free AI tools that help you as a startup effortlessly create marketing content and social media posts. Save time and stay consistent – without a budget.

ai-toolsstartupsmarketing-automationsocial-mediacontent-creation
Read more
BlogJun 16, 2026

Automated Nextcloud Backups on VPS with BorgBackup and AWS S3

Learn how to automatically back up your Nextcloud instance on VPS with BorgBackup and AWS S3. Step-by-step guide for disaster recovery.

nextcloudvpsbackupborgbackupaws s3
Read more
BlogJun 15, 2026

Install and Optimize Nextcloud on a VPS

Learn how to install Nextcloud on your VPS and configure it for maximum performance. Step-by-step guide for a fast and secure cloud solution.

nextcloudvpsinstallationperformancecloud
Read more
BlogJun 15, 2026

Optimize Nextcloud Security on Your VPS: Fail2Ban, 2FA & Audits

Learn how to secure your Nextcloud instance on a VPS with Fail2Ban, two-factor authentication, and regular security audits. Effectively protect your data from unauthorized access.

nextcloudvpssecurityfail2ban2fa
Read more
BlogJun 15, 2026

GDPR-compliant email archiving in Virtualmin

Learn how to implement efficient email archiving with Virtualmin that meets GDPR requirements. Tips on retention, deletion, and security.

virtualminemail archivinggdprcompliancehosting
Read more
Jun 13, 2026

Company Network for Startups: Choosing Hardware & Software Correctly

You are founding a company and wondering what network equipment is needed? We show you which hardware and software are truly important for a smooth start.

company networknetwork hardwarenetwork softwarestartupit basic equipment
Read more
BlogJun 13, 2026

Linux Distributions for Dedicated Servers: Debian vs Rocky Linux vs openSUSE Leap

Which Linux distribution is best for your dedicated server? We compare Debian, Rocky Linux, and openSUSE Leap in terms of stability and performance.

linuxserverdebianrocky linuxopensuse
Read more
Jun 13, 2026

Email Queue Management in Virtualmin: Retry Strategies to Prevent Message Loss

Learn how to manage email queues in Virtualmin and set up automatic retry strategies to avoid message loss. Step-by-step guide for reliable email delivery.

virtualminemail-queueretry-strategiesmessage-losspostfix
Read more
BlogJun 12, 2026

All-in-One Platform for Small Organizations: Email, Web Server & Website Management

Discover the benefits of an integrated platform with email server, web server, and website management. Save time and costs with our complete solution.

all-in-one platformemail serverweb serverwebsite managementsmall organization
Read more
Jun 12, 2026

Alpine Linux vs. Ubuntu Server vs. CentOS: The Best Choice for Your VPS

Alpine Linux, Ubuntu Server or CentOS? We show the key differences and help you choose the optimal operating system for your VPS – performance-optimized and secure.

alpine linuxubuntu servercentosvps operating systemserver comparison
Read more
BlogJun 12, 2026

Network Structure for Startups: VLANs, Firewall & VPN

Learn how to build a secure and scalable network structure for your startup with VLANs, firewall rules, and VPN access – for productive collaboration from anywhere.

networkvlanfirewallvpnstartup-security
Read more
BlogJun 10, 2026

Nextcloud Optimization on Shared Hosting with PHP-FPM and Redis

Learn how to maximize Nextcloud on shared hosting with PHP-FPM and Redis caching. Tips for best performance configuration.

nextcloudshared-hostingphp-fpmredisoptimization
Read more
BlogJun 10, 2026

Email Archiving in Virtualmin for GDPR & Storage Optimization

Learn how to configure email archiving and retention policies in Virtualmin to stay GDPR compliant and optimize storage space.

virtualminemail archivinggdprstorage optimizationretention policies
Read more
Jun 10, 2026

Nextcloud Scaling on VPS with Docker Swarm and Load Balancing

Learn how to automatically scale Nextcloud on a VPS with Docker Swarm and distribute the load to handle growing user numbers.

nextclouddocker-swarmload-balancingvpsscaling
Read more
BlogJun 10, 2026

Virtualmin API for DevOps: Automated Server Management

Learn how the Virtualmin API optimizes your DevOps workflows. Automate server tasks, integrate CI/CD, and save time on management.

automationvirtualminapidevopsserver management
Read more
BlogJun 10, 2026

5 Free AI Tools for Startup Workflows & Productivity

Discover the five best free AI tools to automate workflows and boost productivity for your startup. From chatbots to data analysis – find practical helpers here.

ai-toolsautomationproductivitystartupsfree
Read more