Blog

Knowledge that actually helps.

Articles about web hosting, domains, privacy, WordPress and digital tools for associations and small organisations. Written clearly, without expertise required.

Virtualmin: Setting Up a Secure Network for Your Organization

Learn in this guide how to set up a secure network for your organization with Virtualmin. From installation to configuration of firewalls and SSL certificates.

virtualminserver managementsslnetwork securityorganization
Read more

Virtualmin: Manage Custom PHP Versions per Domain

Learn how to set an individual PHP version for each domain with Virtualmin and avoid compatibility issues. Perfect for developers and webmasters.

virtualminwebhostingphp-versionsdomain-managementcompatibility
Read more

Advanced Spam Filter Settings in Virtualmin for Small Organizations

Learn how to configure advanced spam filters in Virtualmin to protect your small organization from unwanted emails. Step-by-step guide with tips.

virtualminsmall organizationemail-securityspam-filterserver-configuration
Read more

Setting up Nextcloud on Shared Hosting for Small Teams

Learn how to install Nextcloud on shared hosting, enable file versions, and set sharing permissions for your team – without a VPS.

nextcloudshared-hostingsmall teamsfile versionssharing permissions
Read more

Setting up Email Forwarding and Catch-All Addresses in Virtualmin

Learn how to set up email forwarding and catch-all addresses in Virtualmin. Ideal for small businesses that don't want to miss any emails. Step-by-step guide.

virtualminemail-forwardingsmall-businesscatch-allemail-setup
Read more

Virtualmin for Beginners: Setting Up a Virtual Server

Learn how to set up your first virtual server with Virtualmin. From installation to management – this guide helps you get your website online quickly.

virtualminvpsweb hostingserver setupbeginners
Read more

Configuring Email Filter Rules in Virtualmin for Small Organizations

Learn how to set up advanced email filter rules with Virtualmin to block spam, prevent phishing, and enhance your organization's security.

virtualminsmall organizationsemail-filterspam-protectionphishing
Read more

Free Open-Source Tools for Email, Server, and Website Management

Learn how to efficiently integrate email, server, and website management for your small organization using Virtualmin and other open-source tools – step by step.

virtualminserver managementemail serverwebhostingopen-source
Read more

Virtualmin Integration: Email, Web Hosting, and Server Management for Small Organizations

Learn how to bundle email, web hosting, and server management in one instance with Virtualmin – ideal for small teams wanting to save costs and retain control.

virtualminserver managementsmall organizationweb hostingemail
Read more

Nextcloud on VPS: Data Protection and Access Control for Small Teams

Learn how to set up Nextcloud on your VPS to securely share data and control access. Perfect for small teams that take data protection seriously.

nextcloudvpsteamdatenschutzzugriffskontrolle
Read more

Email Archiving with Virtualmin for Small Organizations

Learn how to set up and manage an efficient email archiving strategy for your small organization using Virtualmin – including tips for compliance and storage.

virtualminserver managementemail archivingcompliancesmall-business
Read more

Troubleshooting Email Delivery Problems with Virtualmin

Email delivery issues can cripple a small organization's operations. This guide helps you identify and fix the most common causes with Virtualmin.

virtualminspfemail deliverytroubleshootingdns
Read more

Setting Up Email Forwarding with Virtualmin – Guide for Small Organizations

Learn how to create email forwarding in Virtualmin to automatically redirect incoming messages to other addresses – ideal for teams and associations.

virtualminsmall organizationwebhostingemail-forwarding
Read more

Automated Backup Workflow with Virtualmin for Small Organizations

Learn how to set up a reliable automated backup workflow with Virtualmin – perfect for small organizations looking to protect their data.

automationvirtualminbackupsmall organizationsworkflow
Read more

Complete Solution for Small Organizations: Email, Server, and Website from One Source

Learn how small organizations benefit from an integrated solution for email, server, and website. Save time, costs, and stress with a single provider.

small organizationserveremailwebsitecomplete solution
Read more

Optimal Email Security for Small Businesses: Configuring SPF, DKIM, and DMARC Correctly

Learn how to secure your email communication with SPF, DKIM, and DMARC, prevent phishing, and improve deliverability. A guide for small businesses.

spfdkimdmarcemail-securitysmall-businesses
Read more

Virtualmin vs. cPanel: Modular Architecture and Cost Savings for Small Businesses

Virtualmin offers a modular, cost-effective alternative to cPanel for small businesses. Learn how its architecture and pricing benefit your budget and requirements.

virtualminwebhostingcpanelcost savingsmodular-architecture
Read more

5 Free AI Tools for Startups: Automate Social Media Planning

Discover 5 free AI tools that let you automate your social media planning and content creation as a startup. Save time and increase your reach.

ai-toolsautomationstartupssocial-mediacontent-creation
Read more

Nextcloud on Shared Hosting: Setup with SSL and Performance Tuning

Learn how to set up Nextcloud on shared hosting, enable automatic SSL encryption, and optimize performance for small teams – including tips for choosing the right hosting.

nextcloudshared-hostingperformancesslsmall teams
Read more

cPanel vs Virtualmin: Modular Architecture and Cost Savings for Small Organizations

Looking for a web hosting control panel that is flexible and affordable? Our comparison shows why Virtualmin with its modular architecture is often the better choice for small organizations.

virtualminwebhostingcpanelcost comparisonmodular
Read more

Install Nextcloud on VPS: Security Updates and Firewall

Learn how to install Nextcloud on your VPS, set up automated security updates, and configure a firewall – for a secure and reliable cloud solution.

nextcloudvpsfirewallinstallationsecurity updates
Read more

Optimize Nextcloud on VPS: Scaling & Failover for Teams

Learn how to optimize Nextcloud on a VPS with automatic scaling and failover for growing teams. Tips on performance, load balancing, and high availability.

nextcloudvpsscalingfailoverteam
Read more

Nextcloud on Shared Hosting: First Steps for Beginners

Learn how to install, configure, and optimize Nextcloud on your shared hosting for best performance. A beginner's guide with practical tips.

nextcloudshared-hostinginstallationperformance tuningguide
Read more

Setting up Nextcloud on a VPS: Security & Performance for Small Organizations

Learn how to manually install Nextcloud on your VPS, optimally secure it, and configure it for performance for small teams. Includes hardening tips and backup strategy.

nextcloudvpssecurityperformanceguide
Read more

10 Free AI Tools for Startup Teams to Optimize Project Management and Collaboration

Discover 10 powerful, free AI tools that help your startup team optimize project management and collaboration. From task management to communication – find the best helpers here.

ai-toolsfreestartupproject-managementcollaboration
Read more

The Ultimate Guide to Choosing the Right Network Hardware for Small Organizations on a Budget

Discover how to choose the perfect network hardware for your small organization on a tight budget. Tips on routers, switches, access points, and more.

small organizationnetwork hardwarebudgetrouterswitch
Read more

Optimizing Email Protocols IMAP, POP3, and SMTP

Learn how to efficiently manage your business emails with IMAP, POP3, and SMTP. We show you the differences and provide tips for optimal configuration.

imappop3smtpemail configurationemail protocols
Read more

7 Free AI Tools for Automating Invoicing and Accounting

Discover 7 free AI tools that help startups automate invoicing and accounting. Save time and avoid errors with these smart solutions.

ai-toolsautomationstartupsaccountinginvoicing
Read more

Package Management under Linux: apt, yum and dnf Compared

Learn how the package management tools apt, yum and dnf differ. We show you the advantages and disadvantages for various Linux distributions and help you choose.

linuxpackage managementaptyumdnf
Read more

Scalable Network Architecture for Startups on a Small Budget

Learn how to build a flexible and cost-efficient network architecture as a startup that grows with your company. Tips on cloud usage and virtualization.

startupcloudnetwork architecturescalablebudget
Read more

Automate Server Tasks with Virtualmin API Scripts

Learn how to efficiently automate recurring server tasks with Virtualmin API scripts. Save time and avoid errors with clever scripts.

automationvirtualminapiwebhostingserver-scripts
Read more

Optimizing Nextcloud on Shared Hosting: Redis Caching and Cron Jobs

Learn how to set up Nextcloud on shared hosting with Redis caching and cron jobs for maximum performance. Tips for fast synchronization and stable usage.

nextcloudshared-hostingcron jobsredis cachingperformance optimization
Read more

Multi-Server Management in Virtualmin: How to Centrally Manage Multiple Domains

Learn how to centrally manage multiple servers and domains with Virtualmin. Step-by-step guide for efficient multi-server management.

virtualminserver managementmulti-serverdomainscentral-management
Read more

Advanced Backup Strategies in Virtualmin for Reliable Data Protection

Learn how to implement advanced backup strategies with Virtualmin to secure your data and quickly restore it in an emergency. Includes tips for automation and external storage.

virtualminhostingbackupdata protectionrestoration
Read more

Cost and Time Savings through Integrated Solutions for Small Organizations

Learn how small organizations can save time and money with bundled email, server, and website solutions. Tips for choosing the right provider.

web hostingcost savingsemail hostingtime savingsintegrated solutions
Read more

The Guide to Setting Up SPF, DKIM, and DMARC for Improved Email Deliverability on Shared Hosting

Learn how to improve your email deliverability on shared hosting with SPF, DKIM, and DMARC. Step-by-step guide for beginners.

shared-hostingspfdkimdmarcemail-deliverability
Read more

All-in-One Platforms for Small Organizations: Email, Server & Website Comparison

Looking for an all-in-one solution for email, server, and website? We compare the best platforms for small organizations and show you what to look out for.

small organizationall-in-oneemail hostingweb hosting comparisonwebsite builder
Read more

Security Updates Compared: Ubuntu LTS vs CentOS Stream vs Debian Stable

Which Linux distribution provides the best security updates for web hosting? We compare Ubuntu LTS, CentOS Stream, and Debian Stable in terms of timeliness, support, and stability.

webhostingsecurity updatesubuntu-ltscentos-streamdebian-stable
Read more

Running Nextcloud Securely on Shared Hosting

Learn how to secure Nextcloud on shared hosting with automatic updates and security scans. Tips for updates, scans, and configuration.

nextcloudshared-hostingsecuritycloudautomatic updates
Read more

Virtualmin vs cPanel: Security Features Compared – Firewall & Fail2Ban

Learn how Virtualmin and cPanel compare in terms of security. We highlight Virtualmin's integrated firewall and Fail2Ban support and show you the differences.

virtualminfirewallsecurityfail2bancpanel
Read more

Free All-in-One Platforms for Small Organizations

Discover free platforms that combine email, server, and website. Ideal for small organizations with limited budgets.

serverfree-platformsall-in-oneemailwebsite
Read more

5 Free AI Tools for Startups to Optimize Customer Communication and Support Tickets

Discover 5 powerful, free AI tools that help you as a startup improve customer communication and handle support tickets more efficiently.

ai-toolsstartupsfreecustomer-communicationsupport-tickets
Read more

The Ultimate Guide to Migrating from cPanel to Virtualmin

Switch from cPanel to Virtualmin: Save costs and gain flexibility. Our guide shows you step by step how to migrate successfully.

virtualminwebhostingcpanelmigrationcost savings
Read more

Advanced Virtualmin Features: DNS Clustering and Load Balancing for High Availability

Learn how to maximize the availability of your websites with DNS clustering and load balancing in Virtualmin. Step-by-step guide for beginners and professionals.

virtualminload-balancingwebhostingdns-clusteringhigh-availability
Read more

Cron Jobs in Virtualmin: Automated System Tasks Made Easy

Learn how to set up and manage cron jobs with Virtualmin to automatically execute recurring tasks like backups or updates. Ideal for admins and web developers.

automationvirtualminserver managementweb hostingcron jobs
Read more

Fix Email Delivery Problems in Virtualmin: Log Analysis & Checks

Learn how to solve common email delivery problems in Virtualmin with log analysis and configuration checks. Step-by-step guide for admins.

virtualminemail deliverytroubleshootinglog analysismail server
Read more

Setting up Nextcloud on Shared Hosting: Step-by-Step Guide

Learn how to install Nextcloud on shared hosting, automatically scale PHP resources, and optimize cron jobs for a high-performance cloud solution.

nextcloudshared-hostingphpcron jobscloud installation
Read more

Real-time Document Editing on VPS with OnlyOffice or Collabora Online

Learn how to collaborate on documents in real time on your VPS with OnlyOffice or Collabora Online – perfect for teams and freelancers.

nextcloudvpsonlyofficecollabora-onlinereal-time collaboration
Read more

Virtualmin vs cPanel: Automation Features Compared

Discover the advanced automation features of Virtualmin compared to cPanel. Learn how to manage your server more efficiently and save costs with Virtualmin.

automationvirtualminserver managementcpanelweb hosting
Read more

Nextcloud on Shared Hosting: Performance Tuning Despite Shared Resources

Learn how to optimally set up Nextcloud on shared hosting and maximize performance with caching, PHP settings, and database tuning.

nextcloudshared-hostingoptimizationperformance tuningcaching
Read more

Virtualmin vs. cPanel: Better Cost Control for Resellers

Virtualmin offers resellers and agencies a cost-effective alternative to cPanel. Learn how to manage multiple client websites with Virtualmin and save real money.

virtualmincpanelreseller-hostingcost-controlresource-management
Read more

Setting up Nextcloud on a VPS: SSL & Database Optimization

Learn how to install Nextcloud on your VPS, automatically manage SSL, and optimize database performance for maximum speed.

nextcloudvpsoptimizationssldatabase
Read more

Setting up SPF, DKIM, and DMARC in Virtualmin for Better Deliverability

Learn how to configure SPF, DKIM, and DMARC in Virtualmin to improve your email deliverability and protect your domain from abuse.

virtualminspfdkimdmarcemail-deliverability
Read more

5 Free AI Tools for Accounting and Invoice Management

Discover 5 free AI tools that help startups with accounting and invoice management. Save time and avoid errors with smart automation.

ai-toolsstartupsfreeaccountinginvoice-management
Read more

Discovering Virtualmin Interface: Dashboard, Templates & User Management

Get to know Virtualmin: From login to dashboard, server templates, and user management – a practical guide for beginners.

virtualmindashboardserver templatesuser managementwebhosting
Read more

5 Free AI Tools for Startups: Automate Marketing Content & Social Media Posts

Discover five free AI tools that help you as a startup effortlessly create marketing content and social media posts. Save time and stay consistent – without a budget.

ai-toolsstartupsmarketing-automationsocial-mediacontent-creation
Read more

Automated Nextcloud Backups on VPS with BorgBackup and AWS S3

Learn how to automatically back up your Nextcloud instance on VPS with BorgBackup and AWS S3. Step-by-step guide for disaster recovery.

nextcloudvpsbackupborgbackupaws s3
Read more

Install and Optimize Nextcloud on a VPS

Learn how to install Nextcloud on your VPS and configure it for maximum performance. Step-by-step guide for a fast and secure cloud solution.

nextcloudvpsinstallationperformancecloud
Read more

Optimize Nextcloud Security on Your VPS: Fail2Ban, 2FA & Audits

Learn how to secure your Nextcloud instance on a VPS with Fail2Ban, two-factor authentication, and regular security audits. Effectively protect your data from unauthorized access.

nextcloudvpssecurityfail2ban2fa
Read more

GDPR-compliant email archiving in Virtualmin

Learn how to implement efficient email archiving with Virtualmin that meets GDPR requirements. Tips on retention, deletion, and security.

virtualminemail archivinggdprcompliancehosting
Read more

Company Network for Startups: Choosing Hardware & Software Correctly

You are founding a company and wondering what network equipment is needed? We show you which hardware and software are truly important for a smooth start.

company networknetwork hardwarenetwork softwarestartupit basic equipment
Read more

Linux Distributions for Dedicated Servers: Debian vs Rocky Linux vs openSUSE Leap

Which Linux distribution is best for your dedicated server? We compare Debian, Rocky Linux, and openSUSE Leap in terms of stability and performance.

linuxserverdebianrocky linuxopensuse
Read more

Email Queue Management in Virtualmin: Retry Strategies to Prevent Message Loss

Learn how to manage email queues in Virtualmin and set up automatic retry strategies to avoid message loss. Step-by-step guide for reliable email delivery.

virtualminemail-queueretry-strategiesmessage-losspostfix
Read more

All-in-One Platform for Small Organizations: Email, Web Server & Website Management

Discover the benefits of an integrated platform with email server, web server, and website management. Save time and costs with our complete solution.

all-in-one platformemail serverweb serverwebsite managementsmall organization
Read more

Alpine Linux vs. Ubuntu Server vs. CentOS: The Best Choice for Your VPS

Alpine Linux, Ubuntu Server or CentOS? We show the key differences and help you choose the optimal operating system for your VPS – performance-optimized and secure.

alpine linuxubuntu servercentosvps operating systemserver comparison
Read more

Network Structure for Startups: VLANs, Firewall & VPN

Learn how to build a secure and scalable network structure for your startup with VLANs, firewall rules, and VPN access – for productive collaboration from anywhere.

networkvlanfirewallvpnstartup-security
Read more

Nextcloud Optimization on Shared Hosting with PHP-FPM and Redis

Learn how to maximize Nextcloud on shared hosting with PHP-FPM and Redis caching. Tips for best performance configuration.

nextcloudshared-hostingphp-fpmredisoptimization
Read more

Email Archiving in Virtualmin for GDPR & Storage Optimization

Learn how to configure email archiving and retention policies in Virtualmin to stay GDPR compliant and optimize storage space.

virtualminemail archivinggdprstorage optimizationretention policies
Read more

Nextcloud Scaling on VPS with Docker Swarm and Load Balancing

Learn how to automatically scale Nextcloud on a VPS with Docker Swarm and distribute the load to handle growing user numbers.

nextclouddocker-swarmload-balancingvpsscaling
Read more

Virtualmin API for DevOps: Automated Server Management

Learn how the Virtualmin API optimizes your DevOps workflows. Automate server tasks, integrate CI/CD, and save time on management.

automationvirtualminapidevopsserver management
Read more

5 Free AI Tools for Startup Workflows & Productivity

Discover the five best free AI tools to automate workflows and boost productivity for your startup. From chatbots to data analysis – find practical helpers here.

ai-toolsautomationproductivitystartupsfree
Read more